DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and AT4G25600

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_194290.2 Gene:AT4G25600 / 828665 AraportID:AT4G25600 Length:291 Species:Arabidopsis thaliana


Alignment Length:256 Identity:57/256 - (22%)
Similarity:93/256 - (36%) Gaps:62/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 CRGEWPKKSSPELICRYNRDTSAFLKLA-----PLKLEFLSVQPMILLYHDVLYENEFKSMRDIA 331
            |.|...|:...:.|...:.||.|...|.     |.::..||..|.:.||...|.|.|...:..:.
plant    23 CSGGSRKELRDKEITSKSDDTQASYVLGSKFVDPTRVLQLSWLPRVFLYRGFLSEEECDHLISLR 87

  Fly   332 MYNGSMIDGWTYVDFDKKGNPKQQDRVVKMIAFQGTTAPFTLSINRRMADMSGLEMRDNMVLYLT 396
            .....:..    ||.|.|   .|.|.||                       :|:|.:.:...:|.
plant    88 KETTEVYS----VDADGK---TQLDPVV-----------------------AGIEEKVSAWTFLP 122

  Fly   397 NYGLGGHF----------GKHVDYVELAKRPPDFFADFGGDRIATALIYASDIPLGGTTVFTKLK 451
            ... ||..          ||.:||  ..:.|.....:   ..:||.::|.|:...||..:|...:
plant   123 GEN-GGSIKVRSYTSEKSGKKLDY--FGEEPSSVLHE---SLLATVVLYLSNTTQGGELLFPNSE 181

  Fly   452 I-----------AVQPKKGSALIWFNLNHAGEPDPLTEHSVCPVVLGSRWIISKWIHERQQ 501
            :           .::|.||:|:::|........|..:.|..||||.|...:.:|.|:.::|
plant   182 MKPKNSCLEGGNILRPVKGNAILFFTRLLNASLDGKSTHLRCPVVKGELLVATKLIYAKKQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 30/148 (20%)
AT4G25600NP_194290.2 2OG-FeII_Oxy <159..237 CDD:304390 20/77 (26%)
ShKT 251..291 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.