DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and AT3G28480

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:257 Identity:70/257 - (27%)
Similarity:106/257 - (41%) Gaps:82/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 PLKLEFLSVQPMILLYHDVLYENEFKSMRDIA--MYNGSMIDGWTYVDFDKKGNPKQQDRVVKMI 362
            |.::..||..|.:.||...|.:.|......:|  ....||:     .|.|...:.:.:|.|    
plant    53 PTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMV-----ADNDSGESVESEDSV---- 108

  Fly   363 AFQGTTAPFTLSINRR----MADMSGLEMRDNMV--------------------LYLTNYGLGGH 403
                       |:.|:    :|:|..||: |::|                    :.:.:|..|..
plant   109 -----------SVVRQSSSFIANMDSLEI-DDIVSNVEAKLAAWTFLPEENGESMQILHYENGQK 161

  Fly   404 FGKHVDYVELAKRPPDFFAD-----FGGDRIATALIYASDIPLGGTTVF-------TKLK----- 451
            :..|.||          |.|     .||.||||.|:|.|::..||.|||       |:||     
plant   162 YEPHFDY----------FHDQANLELGGHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWT 216

  Fly   452 ------IAVQPKKGSALIWFNLNHAGEPDPLTEHSVCPVVLGSRWIISKWIHER--QQVFKK 505
                  .||:|:||.||::|||:.....|..:.|..||||.|.:|..::|||.:  ::.|.|
plant   217 ECAKQGYAVKPRKGDALLFFNLHPNATTDSNSLHGSCPVVEGEKWSATRWIHVKSFERAFNK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 51/174 (29%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.