DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and P4H2

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:251 Identity:69/251 - (27%)
Similarity:103/251 - (41%) Gaps:65/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 SSPELICRYNRDTSAFLKLAPLKLEFLSVQPMILLYHDVLYENEFKSMRDIAMYN---GSMIDGW 341
            |||..|            :.|.|::.:|.:|...:|...|.:.|...:..:|..|   .::.|  
plant    27 SSPSSI------------INPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVAD-- 77

  Fly   342 TYVDFDKKGNPKQQDRVVKMIAFQGT-----TAPFTLSINRRMADMSGLEMRDNMVLYLTNYGLG 401
                     |...:.:|..:....||     ..|....|..:::..:.|...:...|.:..|..|
plant    78 ---------NDNGESQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHG 133

  Fly   402 GHFGKHVDY----VELAKRPPDFFADFGGDRIATALIYASDIPLGGTTVF--------------- 447
            ..:..|.||    |.:|:         ||.||||.|:|.|::..||.|||               
plant   134 QKYDAHFDYFHDKVNIAR---------GGHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENK 189

  Fly   448 ------TKLKIAVQPKKGSALIWFNLNHAGEPDPLTEHSVCPVVLGSRWIISKWIH 497
                  .|..|||:||||:||::|||.....|||.:.|..|||:.|.:|..:||||
plant   190 DDLSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 49/152 (32%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 57/209 (27%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.