DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and P4H5

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:239 Identity:67/239 - (28%)
Similarity:106/239 - (44%) Gaps:65/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LEFLSVQPMILLYHDVLYENEFKSMRDIAMYNGSMIDGWTYVDFDKKGNPKQ------------- 354
            :|.:|.:|..::||:.|...|.:.:  |::...||:.. |.|| :|.|..|.             
plant    80 VEVISWEPRAVVYHNFLTNEECEHL--ISLAKPSMVKS-TVVD-EKTGGSKDSRVRTSSGTFLRR 140

  Fly   355 -QDRVVKMIAFQGTTAPFTLSINRRMADMSGLEMRDNMVLYLTNYGLGGHFGKHVDYVELAKRPP 418
             .|.||::             |.:|::|.:.:.:.:...|.:.:|.:|..:..|.||        
plant   141 GHDEVVEV-------------IEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDY-------- 184

  Fly   419 DFFADF----GGDRIATALIYASDIPLGGTTVFT-------------------KLKIAVQPKKGS 460
             |..:|    ||.||||.|:|.||:..||.|||.                   |..::|.|||..
plant   185 -FLDEFNTKNGGQRIATVLMYLSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRD 248

  Fly   461 ALIWFNLNHAGEPDPLTEHSVCPVVLGSRWIISKWIHERQQVFK 504
            ||:::|:......||.:.|..||||.|::|..:||.|..:  ||
plant   249 ALLFWNMRPDASLDPSSLHGGCPVVKGNKWSSTKWFHVHE--FK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 45/150 (30%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 65/237 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.