DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:213 Identity:56/213 - (26%)
Similarity:98/213 - (46%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 LKLEFLSVQPMILLYHDVLYENEFKSMRDIAMYNGSMIDGWTYVDFDKK--GNPKQQDRVVKMIA 363
            :|:|.::.:|.:::|.|:.   ..|.:||       .::...::.|:::  .|....|.|.|:..
 Worm    22 VKVEVVAWRPGLVIYRDLF---TGKQVRD-------HLELMEHLKFEEQLVVNDDGNDIVSKIRR 76

  Fly   364 FQGTTA-----PFTLSI----NRRMADMSGLEMRDNMVLYLTNYGLGGHFGKHVDYVEL-AKRPP 418
            ..||..     |...||    ...:.:::.....|.:.|   :|..|||:..|.||:.. :::..
 Worm    77 ANGTQVFHEDHPAARSIWDTAKNLLPNLNFKTAEDILAL---SYNPGGHYAAHHDYLLYPSEKEW 138

  Fly   419 DFFADFGGDRIATALIYASDIPLGGTTVFTKLKIAVQPKKGSALIWFNLNHAGEPDPLTEHSVCP 483
            |.:....|:|..|.::.......||.|||.:|..||:.|.|.|..|||.....|.:.|:||:.||
 Worm   139 DEWMRVNGNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQEDLSEHAGCP 203

  Fly   484 VVLGSRWIISKWIHERQQ 501
            :..|.:.|.:.|:..|.|
 Worm   204 IYKGQKQISTIWLRMRDQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 39/137 (28%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 49/183 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.