DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and phy-4

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:264 Identity:67/264 - (25%)
Similarity:111/264 - (42%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 DEYLSGDEKIFQEVAARLKRKPTKLERGCRGEWPKKSSPELICRYNRDTSAFLKLAPLKLEFLSV 308
            ||.|..::||:.:....|           ||:  ......|:| |.......::    |:|.||.
 Worm    23 DETLEFNDKIWDKCGKEL-----------RGD--SSRDGRLVC-YRLHKHLLIR----KVEILSS 69

  Fly   309 QPMILLYHDVLYE-------NEFKSMRDIAMYNGSMIDGWTYVDFDKKGNPKQQDRVVKMIAFQG 366
            :|.||.||:.::.       .|.:::|    .....|.|:|...      .|.|.|.........
 Worm    70 EPFILQYHNQVHRRLAKRAVQEAEALR----LEQLKISGFTTTP------EKSQVRAANGTWLIH 124

  Fly   367 TTAP-FTLSINRRMADMSGLEMRDNMVLYLTNYGLGGHFGKHVDYVELAKRPPDFFADFGGDRIA 430
            |..| |........|:::.|::.......:.:|...|::..|.||:..|....  ..:..|:|||
 Worm   125 TGRPSFARIFEGLQANINSLDLSTAEPWQILSYNADGYYAPHYDYLNPATNVQ--LVEGRGNRIA 187

  Fly   431 TALIYASDIPLGGTTVFTKLKIAVQPKKGSALIWFNLNHAGEPDPLTEHSVCPVVLGSRWIISKW 495
            |.|:.......||||||.:|.:.::||.|..::|.|....||.:..|.|:.||:..|::...:.|
 Worm   188 TVLVILQIAKKGGTTVFPRLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLW 252

  Fly   496 IHER 499
            :||:
 Worm   253 VHEK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 36/128 (28%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 45/184 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3137
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.