DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and phy-2

DIOPT Version :10

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_502317.1 Gene:phy-2 / 178170 WormBaseID:WBGene00004025 Length:539 Species:Caenorhabditis elegans


Alignment Length:48 Identity:17/48 - (35%)
Similarity:23/48 - (47%) Gaps:5/48 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ELFDIEEEVNDEFLASENDGANFVGY----RNVVHDFLCTIDGDKQLL 230
            |||.:..:|.. .||:...|||.|.|    |..:..|...||..|::|
 Worm     2 ELFALLIKVAG-LLATVTVGANVVSYSRFRRQNLAKFRSPIDESKEVL 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..137 CDD:462433
P4Hc <369..497 CDD:214780
phy-2NP_502317.1 P4Ha_N 21..156 CDD:462433 10/28 (36%)
P4Hc 335..508 CDD:214780
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.