DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and p4htm

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_002933103.2 Gene:p4htm / 100486123 XenbaseID:XB-GENE-950282 Length:505 Species:Xenopus tropicalis


Alignment Length:335 Identity:76/335 - (22%)
Similarity:125/335 - (37%) Gaps:109/335 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DNYD----NVKKLIDEYLSGDEKIFQEVAARLKRKPTKLERGCRGEWPKKSSPELICRYNRDTSA 294
            ||.|    ::..|:|....|..:| :||...        .|...|.|   .:||.|    |:..:
 Frog   188 DNLDISKADIFNLLDHNQDGQLQI-KEVLTH--------SRLGNGRW---MTPENI----REMYS 236

  Fly   295 FLKLAPLKLEFLSVQPMILLYHDVLYENEFK--SMRDIAMYNGSMIDGWTYVDFDKKGNPKQQDR 357
            .|:..|..             :.||..:|||  ::||...|.|                 ||:..
 Frog   237 ALRADPDG-------------NGVLSLDEFKKLNLRDFHKYLG-----------------KQEVT 271

  Fly   358 VVKMI-------AFQGTTAPFTL-SINRRMADMSGLEM---RDNMVLYLTNYGLGGHFGKHVD-- 409
            :..::       .:||..|...| ||.:|:..::.|.:   .::..|.:..|..|||:..|:|  
 Frog   272 MSDLVRNSHHTWLYQGEGAHHVLRSIRQRVIKLTHLPLDIVENSEPLQVVRYDTGGHYHAHMDSG 336

  Fly   410 --YVELA----KRPPDFFADFGGD-RIATALIYASDIPLGGTTVF-------------------- 447
              :.|.|    |...:..|.|... |..|.|.|.:::..||.|.|                    
 Frog   337 PVFPETACTHTKLTTNETAPFETSCRYVTVLFYLNNVTGGGETTFPVADNRTYEELSLIQNDVDL 401

  Fly   448 -------TKLKIAVQPKKGSALIWFNL-----NHAGEPDPLTEHSVCPVVLGSRWIISKWIH--- 497
                   .|..:.::|::|:|:.|:|.     ...|:.|....|..|.|..|::||.:.||:   
 Frog   402 RDTRKHCDKGNLRIKPRQGTAVFWYNYLSDGKGWVGDVDEFALHGGCLVTAGTKWIANNWINVDP 466

  Fly   498 --ERQQVFKK 505
              :||..|::
 Frog   467 NKQRQLWFQQ 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 41/172 (24%)
p4htmXP_002933103.2 EF-hand_7 196..256 CDD:372618 20/88 (23%)
P4Hc 273..462 CDD:214780 42/188 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.