DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and P4HA2

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens


Alignment Length:532 Identity:127/532 - (23%)
Similarity:225/532 - (42%) Gaps:143/532 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YSSITRLLKLLEMEEIFITNIKAYTNKLAEKVKNLQAYIDSVDYEFQQSFEDREKYVGNPINAFS 81
            ::||..:..|:..|:..:.::|.|......|:..::::.:.::....:|..|.|.|:.:|:||:.
Human    24 FTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYK 88

  Fly    82 LVRRTHQDLPKWHNYSQQIVGMEELFALEEIIAK----------------VPDKKDMAYSLGEMH 130
            ||:|.:.|.|                |||:::.:                .|..:|...:...:.
Human    89 LVKRLNTDWP----------------ALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALM 137

  Fly   131 RIEQIYDLEAIELARGRIQGKQYDFRPSIRDCVALGEHKFKREDYQRASMWFRVAIKHEPEG--- 192
            |::..|.|:...::||.:.|.:|....|:.||..:|...:...||....:|....:|....|   
Human   138 RLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEA 202

  Fly   193 ---NAEIINSI------LGDPKVNLYTLYAKSMLIFGMIKSNPSMTIAEAKKISYEALNKASLAD 248
               .:::::.:      |||       |:....|...::..:||...|           ..:|..
Human   203 TTTKSQVLDYLSYAVFQLGD-------LHRALELTRRLLSLDPSHERA-----------GGNLRY 249

  Fly   249 IKSLLNE-----LLSQTDDEI-----VYEMNVNKTKPSD-YEIGCRGQFL-----RRRNHVCTYN 297
            .:.||.|     |.:||:.|:     :||..|:.....| ||..|||:.:     |::...|.|:
Human   250 FEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYH 314

  Fly   298 F-TITEFLKLAPLKQEVLNWD-PYIVIYHDVLNDDEIDKLK------------------------ 336
            . .....|.:||.|:|. .|| |:||.|:||::|:||:::|                        
Human   315 HGNRAPQLLIAPFKEED-EWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVAS 378

  Fly   337 ------NHLNDTDAVEVNPIEKRIFQRINELTRLSFE------------------HSDQQIVSKN 377
                  :.|.:.|    :|:..|:.:|:..:|.|:.:                  |.|   .|:|
Human   379 YRVSKSSWLEEDD----DPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFD---FSRN 436

  Fly   378 GPR-THKHKKEYLK-GTLLFFLNNVELGGAMVFPKLKISVFPQKGSCLFWHNTL-----DPRSEP 435
            ..| |.||.....: .|.|.::::||.|||.|||.|..:::|:||:.:||:|.|     |.|:..
Human   437 DERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRH 501

  Fly   436 LECPVLQGNKRV 447
            ..||||.|.|.|
Human   502 AACPVLVGCKWV 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528 29/144 (20%)
2OG-FeII_Oxy 322..449 CDD:304390 49/181 (27%)
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 29/144 (20%)
TPR 207..240 6/39 (15%)
P4Hc 346..519 CDD:214780 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.