DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and AT5G66060

DIOPT Version :10

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:201 Identity:52/201 - (25%)
Similarity:78/201 - (38%) Gaps:71/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 EVLNWDPYIVIYHDVLNDDE----IDKLKNHLNDTDAVE-------------------------- 346
            |:::|:|...:||:.|..:|    |:..|.|:..:..|:                          
plant    79 EIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDKT 143

  Fly   347 VNPIEKRIFQRINELTRLSFEHSD------QQIVSKNGPRTHKHKKEYLK-------GTLLFFLN 398
            :..|||    ||::.|.:..||.:      .:|..|..|.......||..       .|:|.:|:
plant   144 IREIEK----RISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLS 204

  Fly   399 NVELGGAMVFPKLK-------------------ISVFPQKG-SCLFW----HNTLDPRSEPLECP 439
            :||.||..|||..|                   :||.|:.| :.|||    ..||||.|....|.
plant   205 DVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCA 269

  Fly   440 VLQGNK 445
            |::|||
plant   270 VIKGNK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..150 CDD:462433
2OG-FeII_Oxy 322..449 CDD:473886 49/191 (26%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 52/201 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.