DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and AT5G66060

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:201 Identity:52/201 - (25%)
Similarity:78/201 - (38%) Gaps:71/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 EVLNWDPYIVIYHDVLNDDE----IDKLKNHLNDTDAVE-------------------------- 346
            |:::|:|...:||:.|..:|    |:..|.|:..:..|:                          
plant    79 EIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDKT 143

  Fly   347 VNPIEKRIFQRINELTRLSFEHSD------QQIVSKNGPRTHKHKKEYLK-------GTLLFFLN 398
            :..|||    ||::.|.:..||.:      .:|..|..|.......||..       .|:|.:|:
plant   144 IREIEK----RISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLS 204

  Fly   399 NVELGGAMVFPKLK-------------------ISVFPQKG-SCLFW----HNTLDPRSEPLECP 439
            :||.||..|||..|                   :||.|:.| :.|||    ..||||.|....|.
plant   205 DVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCA 269

  Fly   440 VLQGNK 445
            |::|||
plant   270 VIKGNK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 49/191 (26%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 52/201 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.