DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and AT5G18900

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:224 Identity:52/224 - (23%)
Similarity:85/224 - (37%) Gaps:80/224 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 PLKQEVLNWDPYIVIYHDVLNDDEIDKL---------KNHLNDTDAVE----------------- 346
            |.|.:.::..|...:|...|.:.|.|.:         ::.:.|.|:.|                 
plant    34 PSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVRTSSGTFISKG 98

  Fly   347 VNPIEKRIFQRINELTRLSFEHSD--QQIVSKNGPRTHKH------KKEYLKG-----TLLFFLN 398
            .:||...|..:|:..|.|..|:.:  |.:..::|.:...|      |...::|     |:|.:|:
plant    99 KDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVRGGHRMATILMYLS 163

  Fly   399 NVELGGAMVFP---------------------KLKISVFPQKGSCLFWHNTLDPRS--EPLE--- 437
            ||..||..|||                     |..|:|.|:||..|.:.| |.|.:  :||.   
plant   164 NVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFN-LHPDAIPDPLSLHG 227

  Fly   438 -CPVLQGNK-------------RVITQKG 452
             |||::|.|             |::|..|
plant   228 GCPVIEGEKWSATKWIHVDSFDRIVTPSG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 47/205 (23%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 52/224 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.