DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and P4H5

DIOPT Version :10

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:203 Identity:53/203 - (26%)
Similarity:85/203 - (41%) Gaps:75/203 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 EVLNWDPYIVIYHDVLNDDEIDKL---------KNHLND-----------------------TDA 344
            ||::|:|..|:||:.|.::|.:.|         |:.:.|                       .:.
plant    81 EVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLRRGHDEV 145

  Fly   345 VEVNPIEKRIFQRINELTRLSFEHSD--QQIVSKNGPRTHKHKKEYLK-----------GTLLFF 396
            |||  |||    ||::.|.:..|:.:  |.:..:.|.:...|...:|.           .|:|.:
plant   146 VEV--IEK----RISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMY 204

  Fly   397 LNNVELGGAMVFP-------------------KLKISVFPQK-GSCLFWH----NTLDPRSEPLE 437
            |::|:.||..|||                   |..:||.|:| .:.|||:    .:|||.|....
plant   205 LSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGG 269

  Fly   438 CPVLQGNK 445
            |||::|||
plant   270 CPVVKGNK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..150 CDD:462433
2OG-FeII_Oxy 322..449 CDD:473886 48/193 (25%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 53/203 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.