DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and p4htma

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:340 Identity:76/340 - (22%)
Similarity:118/340 - (34%) Gaps:121/340 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SILGDPKVNLYTLYAKSML--IFGMI---KSNPSMTIAEAKKISYEAL-------NKASLADIKS 251
            ||:.|...|:.||..|.:|  |.|.:   :||..|.:|:.|.:::.:|       .:.:..::.|
Zfish   124 SIVPDRTHNMRTLSLKPLLFEIPGFLSVEESNVVMQLAQLKGLTHSSLLTNPDQEEQLTQDELFS 188

  Fly   252 LLN----------ELLS---QTDDEIVYEMNVNK------TKPSD----------------YEIG 281
            ||:          |:||   .||...:...|:.|      |.||.                |...
Zfish   189 LLDLNQDGLLQREEILSLSHSTDGSWLSSYNLRKIHTGLETNPSGVLSLQEFKRVSGGVLRYSGA 253

  Fly   282 CRG-----QFLRRRNHVCTYNFTITEFLKLAPLKQEVLNWDPYIVIYHDVLNDDEIDKLKNHLND 341
            .:|     :..:|..|...|....|..| |..::..|                ..:.:|.:.|.|
Zfish   254 AQGLDGHTKVRQRSTHTRLYLGEGTHHL-LKSVRNRV----------------TRLTRLPSSLVD 301

  Fly   342 -TDAVEVNPIEKRIFQRINELTRLSFEHSDQQIVSKNGPRTHKHKK---------EYLKGTLLFF 396
             ::|:||...|:.:|         |..|.|......:...||.|..         .||  |:|.:
Zfish   302 LSEAMEVVRYEQGVF---------SHAHHDSSPTHPDNSCTHTHLAANTSNQVACRYL--TVLLY 355

  Fly   397 LNNVELGGAMVFP---------------------KLKISVFPQKGSCLFWHN----------TLD 430
            ||:.:.||...||                     |..:.|.|..|:.|.|:|          .||
Zfish   356 LNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYNHLSDGNGWVGELD 420

  Fly   431 PRSEPLECPVLQGNK 445
            ..|...:|.|.:|.|
Zfish   421 EFSLHGDCLVTRGFK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 38/165 (23%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 43/192 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583492
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.