DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and P4htm

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_083220.3 Gene:P4htm / 74443 MGIID:1921693 Length:503 Species:Mus musculus


Alignment Length:165 Identity:42/165 - (25%)
Similarity:56/165 - (33%) Gaps:71/165 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 IEKRIFQRINELTRLS---FEHSDQQIVSKNGPRTHKHKK------------------------- 386
            :.:.|.||:..|||||   .|.|:...|.:.|...|.|..                         
Mouse   290 VMRAIRQRVLRLTRLSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPF 354

  Fly   387 ----EYLKGTLLFFLNNVELGGAMVFP---------------------------KLKISVFPQKG 420
                .|:  |:||:||||..||..|||                           |..:.|.||:|
Mouse   355 ETSCRYM--TVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQG 417

  Fly   421 SCLFWHNTL----------DPRSEPLECPVLQGNK 445
            :.:||:|.|          |..|....|.|.:|.|
Mouse   418 TAVFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 42/165 (25%)
P4htmNP_083220.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
EF-hand_7 193..253 CDD:290234
EFh 195..253 CDD:298682
P4Hc 247..459 CDD:214780 42/165 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.