DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and P4HTM

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:459 Identity:93/459 - (20%)
Similarity:144/459 - (31%) Gaps:174/459 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HNYSQQIVGMEELF----ALEEIIAKVP-----DKKDMAYSLGEMHRIE--QIYDLEAIELARGR 147
            |....|:|...:.|    :|:.::.::|     ::..:...|.:|..::  ||...|..|.|...
Human   121 HERKVQLVTDRDHFIRTLSLKPLLFEIPGFLTDEECRLIIHLAQMKGLQRSQILPTEEYEEAMST 185

  Fly   148 IQGKQYD-FR--PSIRDCVALGEHKFKREDYQRASM---WFRVAIKHEPEGNAEIINSILGDPKV 206
            :|..|.| ||  ...||     .|...||...:..:   |:..     ||...|:..:|..||..
Human   186 MQVSQLDLFRLLDQNRD-----GHLQLREVLAQTRLGNGWWMT-----PESIQEMYAAIKADPDG 240

  Fly   207 NLYTLYAKSMLIFGMIKSNPSMTIAEAKKISYEALNKASLADIKSLLNELLSQTDDEIVYEMNVN 271
            :            |:              :|.:..:...|.|....               |..:
Human   241 D------------GV--------------LSLQEFSNMDLRDFHKY---------------MRSH 264

  Fly   272 KTKPSDYEIGCRGQFLRRRNHVCTYNFTITEFLKLAPLKQEVL---NWDPYIVIYHDVLNDDEID 333
            |.:.|        :.:|..:|...|.......:..| ::|.||   ...|.||...:.|......
Human   265 KAESS--------ELVRNSHHTWLYQGEGAHHIMRA-IRQRVLRLTRLSPEIVELSEPLQVVRYG 320

  Fly   334 KLKNHLNDTDAVEVNPIEKRIFQRINELTRL------SFEHSDQQIVSKN--------------- 377
            :..::....|:..|.|      :.|...|:|      .||.|.:| ||.|               
Human   321 EGGHYHAHVDSGPVYP------ETICSHTKLVANESVPFETSCRQ-VSPNWGLPSILRPGTPMTQ 378

  Fly   378 ------------GPRTH--------KHKK---------EYLKGTLLFFLNNVELGGAMVFP---- 409
                        ||..|        :|.:         .|...|:||:||||..||..|||    
Human   379 AQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADN 443

  Fly   410 -----------------------KLKISVFPQKGSCLFWHNTL----------DPRSEPLECPVL 441
                                   |..:.|.||:|:.:||:|.|          |..|....|.|.
Human   444 RTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVT 508

  Fly   442 QGNK 445
            :|.|
Human   509 RGTK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528 13/64 (20%)
2OG-FeII_Oxy 322..449 CDD:304390 46/211 (22%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 17/95 (18%)
EFh 194..252 CDD:238008 16/93 (17%)
P4Hc 246..519 CDD:214780 61/298 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149324
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.