DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and P4HA1

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 / 5033 HGNCID:8546 Length:534 Species:Homo sapiens


Alignment Length:542 Identity:128/542 - (23%)
Similarity:230/542 - (42%) Gaps:136/542 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YSSITRLLKLLEMEEIFITNIKAYTNKLAEKVKNLQAYIDSVDYEFQQSFEDREKYVGNPINAFS 81
            ::||.::..|:..|:..:|::|.|.....:|::.::.:.:.:|.....:.:|.|.:||:|:|||.
Human    22 FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFK 86

  Fly    82 LVRRTHQDLPKWHNYSQQIV-GMEELFALEEIIAK--VPDKKDMAYSLGEMHRIEQIYDLEAIEL 143
            |::|.:.:   |......:: .|.:.|.....|.:  .|:.:|...:...:.|::..|:|:...:
Human    87 LMKRLNTE---WSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTI 148

  Fly   144 ARGRIQGKQYDFRPSIRDCVALGEHKFKREDYQRASMWFRVAIKHEPEGNAEIINSILGDPKVNL 208
            ::|.:.|.::....:..||..||:..:...||....:|...|::...||....|:.:        
Human   149 SKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKV-------- 205

  Fly   209 YTLYAKSMLIFGMIKSNPSMTIAEAKKISYEALNKASLADIKSLLNELLSQTDDE---------- 263
                  |:|.:                :||....:..| |...||.:.|.:.|.|          
Human   206 ------SVLDY----------------LSYAVYQQGDL-DKALLLTKKLLELDPEHQRANGNLKY 247

  Fly   264 ----IVYEMNVNKTKPSD-----------------------YEIGCRGQFL-----RRRNHVCTY 296
                :..|.:|||:...|                       ||:.|||:.:     |::...|.|
Human   248 FEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRY 312

  Fly   297 N--FTITEFLKLAPLKQEVLNWD-PYIVIYHDVLNDDEIDKLKN-----------HLNDTDAVEV 347
            :  ....:|: |||.|||. .|| |.|:.:||:::|.||:.:|:           |..:|..:..
Human   313 HDGNRNPKFI-LAPAKQED-EWDKPRIIRFHDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTT 375

  Fly   348 ---------------NPIEKRIFQRINELTRLSFEHSDQQIVSKNG------PR---THKHKKEY 388
                           ||:..||..||.:||.|....:::..|:..|      |.   ..|.:.:.
Human   376 AQYRVSKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDA 440

  Fly   389 LK--------GTLLFFLNNVELGGAMVFPKLKISVFPQKGSCLFWHNTL-----DPRSEPLECPV 440
            .|        .|.||::::|..|||.|||::..||:|:||:.:||:|..     |..:....|||
Human   441 FKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPV 505

  Fly   441 LQGNKRV----ITQKGAYNGRP 458
            |.|||.|    :.::|....||
Human   506 LVGNKWVSNKWLHERGQEFRRP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528 29/131 (22%)
2OG-FeII_Oxy 322..449 CDD:304390 49/178 (28%)
P4HA1NP_000908.2 P4Ha_N 25..112 CDD:400573 21/89 (24%)
TPR 205..238 10/63 (16%)
P4Hc 345..518 CDD:214780 47/172 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.