DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and CG4174

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster


Alignment Length:464 Identity:117/464 - (25%)
Similarity:208/464 - (44%) Gaps:79/464 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKLLEMEEIFITNIKAYTNKLAEKVKNLQAYIDSVDYEFQQSFEDREKYVGNPIN---AFSLVRR 85
            |.||:::|..:.|:::|.       |.|:.::..:....:||.|..:....:|.|   .:.::|.
  Fly    37 LSLLKLKETHVNNLQSYK-------KVLKKHLQKIRRAIRQSEELLKSTKTSPRNLIYGYKVLRH 94

  Fly    86 THQDLPKWHNYSQQIVGMEELFALEEIIAKVPDKKDMAYSLGEMHRIEQIYDLEAIELARGRIQG 150
            .|.|.|::....::.:|:|::...:.::.:.|...|...|:|.|||::.:|:|::..:..|.|..
  Fly    95 LHNDWPQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDSYAMTEGFIDD 159

  Fly   151 KQYDFRP-SIRDCVALGEHKFKREDYQRASMWFRVAIKHEPEGNAEIINSILGDPKVNLYTLYAK 214
            |..:.|. |..:|:.||......:||.::..|..:|:.|..:..:         |:|....|:..
  Fly   160 KDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVS---------PEVLKIKLWNY 215

  Fly   215 SMLIFGMIKSNPSM-TIAEAKKISYEALN--------KASLADIKSLLNELLSQTDDEIVYEMNV 270
            ..|:..::::|..: ...||||.:.|.|:        ...|..:|.|.:.....|..:.|:::  
  Fly   216 PNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHLQSNPAKLTKPKKVFQL-- 278

  Fly   271 NKTKPSDYEIGCRGQFLRRRN-HVCTYNFTITEFLKLAPLKQEVLNWDPYIVIYHDVLNDDEIDK 334
                  ..|| |..::.|:.. .||.| ...|.||||||||.|.|:..|||.|::..|...:|:.
  Fly   279 ------QKEI-CSKRYRRKSGVLVCRY-VDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEV 335

  Fly   335 LKN----------HLNDTDAVEVNPIEKR---IFQRINEL----TRLSFEHSDQQIVSKNG---- 378
            |||          ||:...:.::..:...   :.:::|||    |....:.:....|...|    
  Fly   336 LKNVSRPKLQRIEHLSGNCSCKIGNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGN 400

  Fly   379 -----PRTHKHKKEYLKGTLLFFLNNVELGGAMVFPKLKISVFPQKGSCLFWHNTLDPRSEPL-- 436
                 |:.|.      |.....||:|...||.:|||...:.|.|:|||.|.|.|.    .:.|  
  Fly   401 YNPEEPKIHN------KANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL----KKSLIY 455

  Fly   437 -ECPVLQGN 444
             :||:|:||
  Fly   456 HQCPILKGN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528 29/126 (23%)
2OG-FeII_Oxy 322..449 CDD:304390 39/152 (26%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 29/126 (23%)
TPR repeat 169..197 CDD:276809 7/27 (26%)
TPR repeat 202..245 CDD:276809 11/51 (22%)
2OG-FeII_Oxy <362..470 CDD:304390 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.