DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and P4htm

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:165 Identity:42/165 - (25%)
Similarity:56/165 - (33%) Gaps:71/165 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 IEKRIFQRINELTRLS---FEHSDQQIVSKNGPRTHKHKK------------------------- 386
            :.:.|.||:..|||||   .|.|:...|.:.|...|.|..                         
  Rat   290 VMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPF 354

  Fly   387 ----EYLKGTLLFFLNNVELGGAMVFP---------------------------KLKISVFPQKG 420
                .|:  |:||:||||..||..|||                           |..:.|.||:|
  Rat   355 ETSCRYM--TVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQG 417

  Fly   421 SCLFWHNTL----------DPRSEPLECPVLQGNK 445
            :.:||:|.|          |..|....|.|.:|.|
  Rat   418 TAVFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 42/165 (25%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394
P4Hc 247..459 CDD:214780 42/165 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.