DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and phy-4

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:277 Identity:65/277 - (23%)
Similarity:107/277 - (38%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 LLNELLSQTDDEIVYEMNVNKTKPSDYEIGCRGQFLRRRNHVCTYNFTITEFLKLAPLKQEVLNW 316
            :.|.|...||:.:  |.|.........|:  ||...|....||   :.:.:.|.:.  |.|:|:.
 Worm    14 IFNFLTPFTDETL--EFNDKIWDKCGKEL--RGDSSRDGRLVC---YRLHKHLLIR--KVEILSS 69

  Fly   317 DPYIVIYHD---------VLNDDE---IDKLK-------------NHLNDTDAVEV-NPIEKRIF 355
            :|:|:.||:         .:.:.|   :::||             ...|.|..:.. .|...|||
 Worm    70 EPFILQYHNQVHRRLAKRAVQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHTGRPSFARIF 134

  Fly   356 Q----RINELTRLSFEHSDQQIVSKNGPRTHKHKKEYLK---------------GTLLFFLNNVE 401
            :    .||.|...:.|  ..||:|.|....:....:||.               .|:|..|...:
 Worm   135 EGLQANINSLDLSTAE--PWQILSYNADGYYAPHYDYLNPATNVQLVEGRGNRIATVLVILQIAK 197

  Fly   402 LGGAMVFPKLKISVFPQKGSCLFWHNTL---DPRSEPLE--CPVLQGNK---------RVITQKG 452
            .||..|||:|.:::.|:.|..:.|.|||   :..|:.|.  ||:.:|.|         ::.:|..
 Worm   198 KGGTTVFPRLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWVHEKIFSQNT 262

  Fly   453 AYNGRPMQYKKAKSNQK 469
            ...|...|...|::..|
 Worm   263 KSTGLSRQNSLARTGGK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 42/185 (23%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 40/174 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.