DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and C14E2.4

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:193 Identity:42/193 - (21%)
Similarity:70/193 - (36%) Gaps:53/193 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 LKQEVLNWDPYIVIYHDVLN----DDEIDKLKN-HLNDTDAVE----------------VNPIEK 352
            ::.|:|:|.|.:|||.||.:    .|.::.||| .:|:...|.                :.|...
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHS 145

  Fly   353 RI-----------------FQRINELTRLSF-------EHSDQQIVSKNGPRTHKHKKEY--LKG 391
            ..                 ||...:::.||:       .|:| .:...|...:::|..|.  ...
 Worm   146 HAEAQSLMDTATQLLPVFDFQYTEQISALSYIKGGHYALHTD-FLTFANAEDSNRHFGEMGNRLA 209

  Fly   392 TLLFFLNNVELGGAMVFPKLKISVFPQKGSCLFWHN---TLDPRSEPLE--CPVLQGNKRVIT 449
            |.:......|.||..:||:|........|....|.|   .|:..::.|.  ||:..|.|.:.|
 Worm   210 TFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNCNGNLEREAKSLHGGCPIRAGEKIIAT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 36/178 (20%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 33/174 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.