DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18231 and LOC110438249

DIOPT Version :9

Sequence 1:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:206 Identity:59/206 - (28%)
Similarity:93/206 - (45%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RRRNHVCTYNFTITEFLKLAPLKQEVLNWD-PYIVIYHDVLNDDEIDKLK-------NHLNDTDA 344
            |.|..||.|.......|.|  .|:|| .|| |.|:.|||.|::.|||.:|       :.....||
Zfish     5 RERKLVCRYRRGRGNPLML--FKEEV-EWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQVIDA 66

  Fly   345 V-------------------EVNPIEKRIFQRINELTRLSFEHSDQQIVSKNG----PRTHKHKK 386
            |                   :.:|:..::.|||.::|.|..:.::...::..|    ...|...|
Zfish    67 VSGKRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPHYDSK 131

  Fly   387 ------EYLKG----TLLFFLNNVELGGAMVFPKLKISVFPQKGSCLFWHNTL-----DPRSEPL 436
                  ..|:|    |:|.::::|::|||.|||.:..::.|::||.:.|.|.|     |.|:...
Zfish   132 LTNDSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLRNGNEDIRTLHA 196

  Fly   437 ECPVLQGNKRV 447
            .|||..|:|.|
Zfish   197 ACPVFVGSKWV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528
2OG-FeII_Oxy 322..449 CDD:304390 45/171 (26%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 50/181 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.