DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and AT1G20270

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:261 Identity:69/261 - (26%)
Similarity:119/261 - (45%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 INDDSTTPPTDHNLGCRGLFPKKSNLVCRYNSSTNAFLKLAPLKMEEISRDPYIVMFHEVISDKD 336
            ||:|.:: |.|.:...|....:...|..|.:..|           |.:|.:|...::|..:|.::
plant    44 INNDESS-PIDLSYFRRAATERSEGLGKRGDQWT-----------EVLSWEPRAFVYHNFLSKEE 96

  Fly   337 IEEM---------KGEITEMENGWTSLGDPKEIVSRV------YWIRKESSFSKRINQRISDMTG 386
            .|.:         |..:.:.|.|       |...|||      :..|......|.|.:||:|.|.
plant    97 CEYLISLAKPHMVKSTVVDSETG-------KSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTF 154

  Fly   387 FKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEVDVNNTLGDRIGSIIFYAGEVSQGGQTVFPDL 451
            ...:....:|:.::..|..::||||::.|   |.:..|. |.|:.:::.|..:|.:||:||||..
plant   155 IPADHGEGLQVLHYEAGQKYEPHYDYFVD---EFNTKNG-GQRMATMLMYLSDVEEGGETVFPAA 215

  Fly   452 K-------------------VAVEPKKGNALFWFNAFDDSTPDPRSLHSVCPVLVGSRWTITKWL 497
            .                   ::|:|:.|:||.:::...|:|.||.|||..|||:.|::|:.|||:
plant   216 NMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWM 280

  Fly   498 H 498
            |
plant   281 H 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375 3/5 (60%)
P4Hc 333..498 CDD:214780 55/198 (28%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 59/214 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.