DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and AT4G35820

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:283 Identity:75/283 - (26%)
Similarity:124/283 - (43%) Gaps:66/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 IYLSN--QGLTNETIDDMANSQLQDAKLMDLEQLISSELKQWINDDSTTPPTDHNLGCRGLFPKK 294
            :||..  |||......|:    :|.....|  :|:..::...:..:..|  .|..|.| .|.|..
plant    11 LYLRQRLQGLKIYETSDL----IQHINTFD--ELVGEQVSVDVKIEEKT--KDMILLC-SLSPLL 66

  Fly   295 SNLVCRYNSSTNAFLKLA-----PLK--MEEISRDPYIVMFHEVIS------------DKDIEEM 340
            :.|.|       :.:|:|     |.:  :|.|:::|...::|..::            |..|...
plant    67 TTLTC-------SMVKVAASLRFPNERWLEVITKEPRAFVYHNFLALFFKICKTNEECDHLISLA 124

  Fly   341 KGEI--TEMENGWTSLGDPKEIVSRV---YWIRK-ESSFSKRINQRISDMTGFKLEEFPAIQLAN 399
            |..:  :::.|..|.||:  |..||.   .:||. .....|.|.:|||:.|....|....:|:.|
plant   125 KPSMARSKVRNALTGLGE--ESSSRTSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVIN 187

  Fly   400 FGVGGYFKPHYDFYTDRLKEVDVNNTLGDRIGSIIFYAGEVSQGGQTVFPDLK-------VAVEP 457
            :.||..|:||:|.:              .||.:::.|..:|.:||:||||:.|       |:|.|
plant   188 YEVGQKFEPHFDGF--------------QRIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRP 238

  Fly   458 KKGNALFWFNAFDDSTPDPRSLH 480
            |||:||.:::...|.:.||.|.|
plant   239 KKGDALLFWSMRPDGSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375 9/47 (19%)
P4Hc 333..498 CDD:214780 51/173 (29%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 18/81 (22%)
P4Hc 115..262 CDD:214780 51/163 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.