DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and AT4G35810

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:217 Identity:64/217 - (29%)
Similarity:108/217 - (49%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 MEEISRDPYIVMFHEVISDKDIEE---------MKGEITEMENGWTSLGDPKEIVSRV------Y 365
            :|.||.:|...::|..:::::.|.         ||.::.:::.|       |.|.|||      :
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTG-------KSIDSRVRTSSGTF 137

  Fly   366 WIRKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEVDVNNTLGDRI 430
            ..|......:.|..||||.|....|....:|:.::.||..::||:|::.|   |.:|... |.||
plant   138 LNRGHDEIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFD---EFNVRKG-GQRI 198

  Fly   431 GSIIFYAGEVSQGGQTVFPDLK-------------------VAVEPKKGNALFWFNAFDDSTPDP 476
            .:::.|..:|.:||:||||..|                   ::|.|||.:||.:::...|::.||
plant   199 ATVLMYLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDP 263

  Fly   477 RSLHSVCPVLVGSRWTITKWLH 498
            .|||..|||:.|::|:.|||.|
plant   264 SSLHGGCPVIKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375
P4Hc 333..498 CDD:214780 58/198 (29%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 64/217 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.