DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and AT4G33910

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:175 Identity:47/175 - (26%)
Similarity:74/175 - (42%) Gaps:30/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 KGEITEMENGW-TSLGDPKEIVSRVYWIRKESSFSKR--INQRISDMTGFKLEEFPAIQLANFGV 402
            |||..|...|. ||.|        .:....|.|....  :.::|:..|........:..:..:.:
plant   119 KGETAENTKGTRTSSG--------TFISASEESTGALDFVERKIARATMIPRSHGESFNILRYEL 175

  Fly   403 GGYFKPHYDFYTDRLKEVDVNNTLGDRIGSIIFYAGEVSQGGQTVFP-----------DLK---- 452
            |..:..|||.:    ...:.......||.|.:.|..:|.:||:|:||           |.|    
plant   176 GQKYDSHYDVF----NPTEYGPQSSQRIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIG 236

  Fly   453 VAVEPKKGNALFWFNAFDDSTPDPRSLHSVCPVLVGSRWTITKWL 497
            :.|:|:||:.|.:::.|.:.|.|..|||..|||..|.:|..|||:
plant   237 LKVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGEKWVATKWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375
P4Hc 333..498 CDD:214780 47/175 (27%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 47/175 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.