DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and P4H13

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:172 Identity:44/172 - (25%)
Similarity:79/172 - (45%) Gaps:27/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 KGEITEMENGWTSLGDPKEIVSRVYWIRKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGGY 405
            |||..|....:.||....:        ..||.....|.::|:..|.|..:.:.:..:..:.:|..
plant   109 KGETAETTQNYRSLHQHTD--------EDESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQK 165

  Fly   406 FKPHYDFYTDRLKEVDVNNTLGDRIGSIIFYAGEVSQGGQTVFP-----------DLK----VAV 455
            :..|||.:    ...:....:..|:.:.:.:...|.:||:|:||           |.:    :.|
plant   166 YDSHYDAF----HSAEYGPLISQRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKV 226

  Fly   456 EPKKGNALFWFNAFDDSTPDPRSLHSVCPVLVGSRWTITKWL 497
            :|::|:|:|::|.|.:.|.|..|||..|||:.|.:|..|||:
plant   227 KPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWVATKWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375
P4Hc 333..498 CDD:214780 44/172 (26%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 44/172 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.