DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and P4H5

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:221 Identity:66/221 - (29%)
Similarity:108/221 - (48%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 MEEISRDPYIVMFHEVISDKDIEEMKGEITEMENGWTSLGDPKEIVSRVY----------WIRKE 370
            :|.||.:|..|::|..:::::.|.:           .||..|..:.|.|.          .:|..
plant    80 VEVISWEPRAVVYHNFLTNEECEHL-----------ISLAKPSMVKSTVVDEKTGGSKDSRVRTS 133

  Fly   371 S-SFSKR--------INQRISDMTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEVDVNNTL 426
            | :|.:|        |.:||||.|...:|....:|:.::.||..::||||::.|   |.:..|. 
plant   134 SGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLD---EFNTKNG- 194

  Fly   427 GDRIGSIIFYAGEVSQGGQTVFPDLK-------------------VAVEPKKGNALFWFNAFDDS 472
            |.||.:::.|..:|..||:||||..:                   ::|.|||.:||.::|...|:
plant   195 GQRIATVLMYLSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDA 259

  Fly   473 TPDPRSLHSVCPVLVGSRWTITKWLH 498
            :.||.|||..|||:.|::|:.|||.|
plant   260 SLDPSSLHGGCPVVKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375
P4Hc 333..498 CDD:214780 59/202 (29%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 66/221 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.