DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and C14E2.4

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:208 Identity:52/208 - (25%)
Similarity:92/208 - (44%) Gaps:21/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LKMEEISRDPYIVMFHEVISDKDIEEMKGEITEME-NGWTSLGDPKEIVSRVYWIRKES-----S 372
            ::||.:|..|.:|::.:|.|.|.:.:....:..:: |....:.|..||....|  |:.:     :
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTY--RQANGTITPA 143

  Fly   373 FSKRINQRISD-----MTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEVDVN---NTLGDR 429
            .|....|.:.|     :..|..:....|...::..||::..|.||.|....| |.|   ..:|:|
 Worm   144 HSHAEAQSLMDTATQLLPVFDFQYTEQISALSYIKGGHYALHTDFLTFANAE-DSNRHFGEMGNR 207

  Fly   430 IGSIIFYAGEVSQGGQTVFPDLKVAVEPKKGNALFWFNAFDDSTPDPRSLHSVCPVLVGSRWTIT 494
            :.:.|....:..:||.|:||.|........|:|..|||...:...:.:|||..||:..|.:...|
 Worm   208 LATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNCNGNLEREAKSLHGGCPIRAGEKIIAT 272

  Fly   495 KWLHYAPQLFVKP 507
            .|:    ::|.:|
 Worm   273 IWI----RIFNQP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375
P4Hc 333..498 CDD:214780 44/178 (25%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 44/182 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3137
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.720

Return to query results.
Submit another query.