DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18233 and LOC110438249

DIOPT Version :9

Sequence 1:NP_649044.3 Gene:CG18233 / 40025 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:235 Identity:78/235 - (33%)
Similarity:127/235 - (54%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 KKSNLVCRYNSSTNAFLKLAPLKM--EEISRD-PYIVMFHEVISDKDIEEMK---------GEIT 345
            ::..|||||.....     .||.:  ||:..| |.|:.:|:.:|:.:|:.:|         .::.
Zfish     5 RERKLVCRYRRGRG-----NPLMLFKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQVI 64

  Fly   346 EMENGWTSLGDPKEI-----VSRVYWI-RKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGG 404
            :..:|       |.:     ||:..|: ..|.....::||||:|:||.:|:...::|:||:|:||
Zfish    65 DAVSG-------KRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGG 122

  Fly   405 YFKPHYDFYTDRLKEVDVNNTLGDRIGSIIFYAGEVSQGGQTVFPDLKVAVEPKKGNALFWFNAF 469
            .::||||   .:|.........|.||.:::.|..:|..||.|||||:..|::||:|:|:.|||..
Zfish   123 QYEPHYD---SKLTNDSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLL 184

  Fly   470 DDSTPDPRSLHSVCPVLVGSRWTITKWLHYAPQLFVKPCS 509
            .:...|.|:||:.|||.|||:|...||:....|.|.:.||
Zfish   185 RNGNEDIRTLHAACPVFVGSKWVANKWIRTYGQEFRRKCS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528
ATP-synt_B <198..278 CDD:304375
P4Hc 333..498 CDD:214780 61/179 (34%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 65/199 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.