DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and AT3G28490

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:218 Identity:48/218 - (22%)
Similarity:91/218 - (41%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 IAPLKVETLSLKPHIVLYHDVIYDSEISKVKNISLPSLKSPLRILYAIDYNLKFAKIREDHQSPL 368
            :.|.::..||..|...||...:.|.|...:..::...|:..:.:........:.:::|......|
plant    27 VDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDSEVRTSSGMFL 91

  Fly   369 SLRIKDMTGEDVQEDTDFQIDNYGICGFRN------FHTDNIELQD---------QTAEL-GDRL 417
            :.|     .:|:..:.:.::..:......|      .|.:|.:..|         :..|| |.|:
plant    92 TKR-----QDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDKKALELGGHRI 151

  Fly   418 TSIMFFMNDVAQGGALAFPN-------LNLTIW-----------PQKGSALVWRNLDHRMQPNQD 464
            .:::.::::|.:||...|||       |....|           |:||.||::.||......:.:
plant   152 ATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTDPN 216

  Fly   465 LLHVSCPVVVGSKWTLVKWLHER 487
            .||.||||:.|.||:..:|:|.|
plant   217 SLHGSCPVIEGEKWSATRWIHVR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528
P4Hc <371..485 CDD:214780 35/147 (24%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 48/217 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.