DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and P4H13

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:213 Identity:52/213 - (24%)
Similarity:79/213 - (37%) Gaps:58/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 SKVKNISLPSLKSPLRILYAIDYNLK--------FAKIREDHQSPLSLRIKDMTGEDVQ------ 381
            |.|.||....|....|:.|..::..|        .||.:. ..|.|:|| |..|.|..|      
plant    61 SSVSNIPFHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKL-KPSTLALR-KGETAETTQNYRSLH 123

  Fly   382 EDTD---------------------------FQIDNYGICGFRNFHTDNIELQDQTAELGDRLTS 419
            :.||                           |.|..|.:....:.|.|.....:....:..|:.:
plant   124 QHTDEDESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEYGPLISQRVVT 188

  Fly   420 IMFFMNDVAQGGALAFP-----NLN----------LTIWPQKGSALVWRNLDHRMQPNQDLLHVS 469
            .:.|::.|.:||...||     |:|          |.:.|::|.|:.:.||......:|..||.|
plant   189 FLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGS 253

  Fly   470 CPVVVGSKWTLVKWLHER 487
            |||:.|.||...||:.::
plant   254 CPVIKGEKWVATKWIRDQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528
P4Hc <371..485 CDD:214780 39/161 (24%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 45/185 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.