DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and p4htma

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:132 Identity:32/132 - (24%)
Similarity:50/132 - (37%) Gaps:40/132 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 HTDN----IELQDQTA-ELGDRLTSIMFFMNDVAQGGALAFP---------------------NL 438
            |.||    ..|...|: ::..|..:::.::|....||..:||                     ..
Zfish   327 HPDNSCTHTHLAANTSNQVACRYLTVLLYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKG 391

  Fly   439 NLTIWPQKGSALVWRNLDHRMQPN-------QDLLHVSCPVVVGSKWTLVKWLH-----ERPQMF 491
            ||.:.|..|:||:|.|  |....|       :..||..|.|..|.|||...|::     :|.:.:
Zfish   392 NLKVKPVAGTALLWYN--HLSDGNGWVGELDEFSLHGDCLVTRGFKWTGSVWVNIDPDQQRQERY 454

  Fly   492 SR 493
            .|
Zfish   455 QR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528
P4Hc <371..485 CDD:214780 30/117 (26%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 29/116 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583472
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.