DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and P4htm

DIOPT Version :10

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_083220.3 Gene:P4htm / 74443 MGIID:1921693 Length:503 Species:Mus musculus


Alignment Length:172 Identity:38/172 - (22%)
Similarity:61/172 - (35%) Gaps:60/172 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LRIKDMTGEDVQEDTDFQIDNYGICGFRNFHTDNIELQDQTA--------------ELGDRLTSI 420
            ||:..::.|.|:.....|:..||..|..:.|.|:..:..:|.              |...|..::
Mouse   299 LRLTRLSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTV 363

  Fly   421 MFFMNDVAQGGALAFP---------------------------NLNLTIWPQKGSALVWRNL--- 455
            :|::|:|..||...||                           ..||.:.||:|:|:.|.|.   
Mouse   364 LFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPD 428

  Fly   456 ---------DHRMQPNQDLLHVSCPVVVGSKWTLVKWLHERP 488
                     |:.       ||..|.|..|:||....|::..|
Mouse   429 GQGWVGEVDDYS-------LHGGCLVTRGTKWIANNWINVDP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..159 CDD:462433
P4Hc <371..485 CDD:214780 36/166 (22%)
P4htmNP_083220.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
EF-hand_7 193..253 CDD:463900
P4Hc 247..459 CDD:214780 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.