DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and CG4174

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster


Alignment Length:530 Identity:124/530 - (23%)
Similarity:231/530 - (43%) Gaps:107/530 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIILSICL--ISLGPPIGLCEITNSAMSIAGMKELVDLEGFFISEMESYTAALKNKIDLMESLLQ 64
            |::::.||  ...|..:...|..:.|:|......|:.|:...::.::||...||..:..:...::
  Fly     5 FVVVTACLGFQVKGEVVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIR 69

  Fly    65 EVQSKREISRRNPEEFVAHPLNAFSLIRRLHEDWTQAELLMLNQVGLEHLQAIETGLEEAQPSDN 129
            :.:...:.::.:|...:    ..:.::|.||.||.|...|:...:|||.: |:...|...||:..
  Fly    70 QSEELLKSTKTSPRNLI----YGYKVLRHLHNDWPQYFRLLKKDLGLEQI-AVSQMLLTQQPTSV 129

  Fly   130 DLNDAIGGIISLQQFYNLQPSDIANGLLMGQQYNASLTTLNCQALANACM----------NFNYD 184
            |..:::|.:..||..|||....:..|.:..:..|....:      |:.|:          ::|..
  Fly   130 DFEESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNIRNWS------ADECLMLGLMYLFLKDYNQS 188

  Fly   185 KYALNWFKAAVDHYNDDRDGQVYREVFDFRLPDLYINYTSVL-----VTKGF------RKAAWKV 238
            :   ||.:.|:.||:|:    |..||...:|    .||.::|     ..||.      :|.|.::
  Fly   189 E---NWLELALYHYDDN----VSPEVLKIKL----WNYPNLLESLVEANKGLGHYFEAKKYANEL 242

  Fly   239 LQDVADLDATLWLLRKDIY---EVGKIDVPDPTFIITPWFDVTGC-LRVGQTSQHLSCHYEKNTS 299
            |....:....|..|.|..:   ...|:..|...|.:....    | .|..:.|..|.|.| .:.:
  Fly   243 LSINPNHTYMLTQLPKLKHLQSNPAKLTKPKKVFQLQKEI----CSKRYRRKSGVLVCRY-VDWT 302

  Fly   300 EFLRIAPLKVETLSLKPHIVLYHDVIYDSEISKVKNISLPSLKSPLRILYAIDYNLKFAKIREDH 364
            .||::||||:|.||:||:|.:::..:...:|..:||:|.|.|:                  |.:|
  Fly   303 PFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQ------------------RIEH 349

  Fly   365 QS--------PLSLRIKD-----------MTGEDVQEDTDFQIDNYGICGFRNFHTDNIELQDQT 410
            .|        .||..:.|           :||..::.:...::.||||.|  |::.:..::.:: 
  Fly   350 LSGNCSCKIGNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAG--NYNPEEPKIHNK- 411

  Fly   411 AELGDRLTSIMFFMNDVAQGGALAFPNLNLTIWPQKGSALVWRNLDHRMQPNQDLLHVSCPVVVG 475
                   .:...|:::..:||.:.||:.:|.:.|:|||.|||.||      .:.|::..||::.|
  Fly   412 -------ANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL------KKSLIYHQCPILKG 463

  Fly   476 SKWTLVKWLH 485
            :.|...|.|:
  Fly   464 NMWVANKVLN 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528 30/129 (23%)
P4Hc <371..485 CDD:214780 30/124 (24%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 29/128 (23%)
TPR repeat 169..197 CDD:276809 6/30 (20%)
TPR repeat 202..245 CDD:276809 12/50 (24%)
2OG-FeII_Oxy <362..470 CDD:304390 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.