DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and phy-4

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:269 Identity:69/269 - (25%)
Similarity:120/269 - (44%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TFI---ITPWFDVT---------GC---LRVGQTSQ--HLSCHYEKNTSEFLRIAPLKVETLSLK 315
            |:|   :||:.|.|         .|   || |.:|:  .|.| |..:....:|    |||.||.:
 Worm    12 TYIFNFLTPFTDETLEFNDKIWDKCGKELR-GDSSRDGRLVC-YRLHKHLLIR----KVEILSSE 70

  Fly   316 PHIVLYHDVIY---------DSEISKVKNISLPSL-----KSPLR------ILYAIDYNLKFAKI 360
            |.|:.||:.::         ::|..:::.:.:...     ||.:|      :::.  ....||:|
 Worm    71 PFILQYHNQVHRRLAKRAVQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHT--GRPSFARI 133

  Fly   361 REDHQSPLSLRIKDMTGEDVQEDTDFQIDNYGICGFRNFHTD------NIELQDQTAELGDRLTS 419
            .|..|:       ::...|:.....:||.:|...|:...|.|      |::|.:..   |:|:.:
 Worm   134 FEGLQA-------NINSLDLSTAEPWQILSYNADGYYAPHYDYLNPATNVQLVEGR---GNRIAT 188

  Fly   420 IMFFMNDVAQGGALAFPNLNLTIWPQKGSALVWRNLDHRMQPNQDLLHVSCPVVVGSKWTLVKWL 484
            ::..:....:||...||.|||.|.|:.|..:||.|.....:.|...||.:||:..|:|.....|:
 Worm   189 VLVILQIAKKGGTTVFPRLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWV 253

  Fly   485 HERPQMFSR 493
            ||:  :||:
 Worm   254 HEK--IFSQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528
P4Hc <371..485 CDD:214780 32/119 (27%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 41/184 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.