DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and C14E2.4

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:253 Identity:59/253 - (23%)
Similarity:97/253 - (38%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 TPWFDVTGCLRVGQTSQHLSCHYEKNTSEFLRIAPLKVETLSLKPHIVLYHDVIYDSEISK---- 332
            |.|          |:|:.:...|.:...|      :::|.||..|.:|:|.||....::|.    
 Worm    62 TTW----------QSSESICIRYVQQFYE------VRMEILSWSPPLVIYRDVFSKKQVSDYLEL 110

  Fly   333 VKNISLPS---LKSPLRILYAIDYNLKFAKIREDHQSPLSLRIKDMTGEDVQEDTDFQID----- 389
            :||:.:..   ::....|.|: .|......|...|....:..:.| |...:....|||..     
 Worm   111 LKNLKMNEQKVVRDDGEIAYS-TYRQANGTITPAHSHAEAQSLMD-TATQLLPVFDFQYTEQISA 173

  Fly   390 -NYGICGFRNFHTD-----NIELQDQ-TAELGDRLTSIMFFMNDVAQGGALAFPNLNLTIWPQKG 447
             :|...|....|||     |.|..:: ..|:|:||.:.:.......:||...||.|........|
 Worm   174 LSYIKGGHYALHTDFLTFANAEDSNRHFGEMGNRLATFIMVFKKAEKGGGTLFPQLGNVFRANPG 238

  Fly   448 SALVWRNLDHRMQPNQDLLHVSCPVVVGSKWTLVKWLHERPQMFSRPC----TTGRKF 501
            .|.:|.|.:..::.....||..||:..|.|.....|:    ::|::|.    .||..|
 Worm   239 DAFLWFNCNGNLEREAKSLHGGCPIRAGEKIIATIWI----RIFNQPIREMQETGGSF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528
P4Hc <371..485 CDD:214780 32/125 (26%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 40/181 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.