DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18234 and LOC110438249

DIOPT Version :9

Sequence 1:NP_649043.3 Gene:CG18234 / 40024 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:227 Identity:76/227 - (33%)
Similarity:116/227 - (51%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 QTSQHLSCHYEKNTSEFLRIAPLKVETLSLKPHIVLYHDVIYDSEISKVKNISLPSLKSPLRILY 349
            |..:.|.|.|.:.....|.:  .|.|....:|.|:.|||.:.:.||..:|.::.|.| |..:::.
Zfish     4 QRERKLVCRYRRGRGNPLML--FKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKL-SRAQVID 65

  Fly   350 AIDYNLKFAKIR--------EDHQ---SPLSLRIKDMTGEDVQEDTDFQIDNYGICGFRNFHTDN 403
            |:......|..|        ||..   :.::.||.|:||.::|.....||.||||.|....|.|:
Zfish    66 AVSGKRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPHYDS 130

  Fly   404 IELQDQTAEL-GDRLTSIMFFMNDVAQGGALAFPNLNLTIWPQKGSALVWRNLDHRMQPNQDL-- 465
            ....|...:| |.|:.:::.:|:||..|||..||::...:.|::|||::|.||  ....|:|:  
Zfish   131 KLTNDSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNL--LRNGNEDIRT 193

  Fly   466 LHVSCPVVVGSKWTLVKWLHERPQMFSRPCTT 497
            ||.:|||.|||||...||:....|.|.|.|:|
Zfish   194 LHAACPVFVGSKWVANKWIRTYGQEFRRKCST 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528
P4Hc <371..485 CDD:214780 48/116 (41%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 64/192 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.