DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4HA2

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens


Alignment Length:507 Identity:129/507 - (25%)
Similarity:214/507 - (42%) Gaps:76/507 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSPRNL----IYG 88
            :|..|......|:..::..|.:|:.|..|.:..|.||:....:.|.|...:.......    :..
Human    22 EFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNA 86

  Fly    89 YKVLRHLHNDWPQYFRLLKKDLGLEQIA---VSQMLLTQQ--PTSVDFEESMGAMHRLQTVYNLD 148
            ||:::.|:.|||..     :||.|:..|   ::.:.:.:|  ||..|...:..|:.|||..|.||
Human    87 YKLVKRLNTDWPAL-----EDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLD 146

  Fly   149 SYAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIKLW 213
            ...::.|.:.. .|.....|.|:|..:|.......||..:..|:|..|...|........|.::.
Human   147 PGTISRGELPG-TKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVL 210

  Fly   214 NYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHL----------QSNPAK 268
            :|      |..|...||....|.:....|||::|:|......|...:.|          ....|:
Human   211 DY------LSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAE 269

  Fly   269 LTKPKKVFQ----------LQKEICS----KRYRRKSGVLVCRY--VDWTPFLKLAPLKMEELSM 317
            |..|:.:::          :.:.:|.    |...|:...|.|||  .:..|.|.:||.|.|:...
Human   270 LATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWD 334

  Fly   318 KPYISIFYGFLGQKDIEVLKNVSRPKLQRI---EHLSG---NCSCKIGNLSTSLHD---VVRKVN 373
            .|:|..:|..:..::||.:|.:::|||.|.   :..:|   ..|.::...|....|   ||.:||
Human   335 SPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVN 399

  Fly   374 ELILGITGFPLKGNQMLEVINYGIAGNYNP---------EEPKIH----NKANAFI-FLSNAGKG 424
            ..:..|||..:|..::|:|.|||:.|.|.|         .:...|    |:...|: ::|:...|
Human   400 RRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAG 464

  Fly   425 GEIVFPSRHLKVRPRKGSMLVWENLKKS------LIYHQCPILKGNMWVANK 470
            |..|||.....:.|:||:.:.|.||.:|      ..:..||:|.|..||:||
Human   465 GATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 32/132 (24%)
TPR repeat 169..197 CDD:276809 7/27 (26%)
TPR repeat 202..245 CDD:276809 9/42 (21%)
2OG-FeII_Oxy <362..470 CDD:304390 40/130 (31%)
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 33/133 (25%)
TPR 207..240 10/38 (26%)
P4Hc 346..519 CDD:214780 51/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.