DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and AT5G66060

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:211 Identity:48/211 - (22%)
Similarity:90/211 - (42%) Gaps:56/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 MEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQ---------------RIEHLSGNCSCKIGNL 361
            :|.:|.:|..|:::.||.:::.:.|..:::|.::               |:...||..      |
plant    78 VEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTF------L 136

  Fly   362 STSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP------EEPKIHNK----ANAFI 416
            :......:|::.:.|...|..|::..:.|:|::|.|...|.|      :|....|.    |...:
plant   137 ARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLM 201

  Fly   417 FLSNAGKGGEIVFPSRH-------------------LKVRPRKG-SMLVWE-----NLKKSLIYH 456
            :||:..:|||.|||:..                   |.|:|:.| ::|.|.     .|..|.::.
plant   202 YLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHG 266

  Fly   457 QCPILKGNMWVANKVL 472
            .|.::|||.|.:.|.|
plant   267 GCAVIKGNKWSSTKWL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
2OG-FeII_Oxy <362..470 CDD:304390 34/142 (24%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 48/211 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.