DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and AT5G18900

DIOPT Version :10

Sequence 1:NP_730342.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:210 Identity:52/210 - (24%)
Similarity:91/210 - (43%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 PLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQR---IEHLSGNCSCKIGNLSTSLHDVVR 370
            |.|::::|.||...::.|||.:.:.:.:.::::..|:|   .::.||  ..|...:.||....:.
plant    34 PSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSG--ESKFSEVRTSSGTFIS 96

  Fly   371 KVNE-LILGI-------TGFPLKGNQMLEVINYGIAGNYNPEEPKIHNKAN----------AFIF 417
            |..: ::.||       |..|.:..:.::|:.|.....|:......|:|.|          ..::
plant    97 KGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVRGGHRMATILMY 161

  Fly   418 LSNAGKGGEIVFP---------------------SRHLKVRPRKGSMLVWENLKKSLI------Y 455
            |||..||||.|||                     .|.:.|:||||..|::.||....|      :
plant   162 LSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPLSLH 226

  Fly   456 HQCPILKGNMWVANK 470
            ..||:::|..|.|.|
plant   227 GGCPVIEGEKWSATK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_730342.2 P4Ha_N 33..159 CDD:462433
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
PLN00052 311..>470 CDD:177683 50/206 (24%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 52/210 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.