DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and AT4G35820

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:198 Identity:46/198 - (23%)
Similarity:84/198 - (42%) Gaps:41/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RRKSGVLVCRYVDWTPFLKLAPLK------------MEELSMKPYISIFYGFLG--------QKD 332
            :.|..:|:|........|..:.:|            :|.::.:|...:::.||.        .::
plant    52 KTKDMILLCSLSPLLTTLTCSMVKVAASLRFPNERWLEVITKEPRAFVYHNFLALFFKICKTNEE 116

  Fly   333 IEVLKNVSRPKLQRI----------EHLSGNCSCKIGNLSTSLHD-VVRKVNELILGITGFPLKG 386
            .:.|.::::|.:.|.          |..|...|.  |....|.|| :|:::.:.|...|..|.:.
plant   117 CDHLISLAKPSMARSKVRNALTGLGEESSSRTSS--GTFIRSGHDKIVKEIEKRISEFTFIPQEN 179

  Fly   387 NQMLEVINYGIAGNYNPEEPKIHNKANAFIFLSNAGKGGEIVFP-------SRHLKVRPRKG-SM 443
            .:.|:||||.:...:.|........|...::||:..||||.|||       .:.:.|||:|| ::
plant   180 GETLQVINYEVGQKFEPHFDGFQRIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDAL 244

  Fly   444 LVW 446
            |.|
plant   245 LFW 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
2OG-FeII_Oxy <362..470 CDD:304390 30/94 (32%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 5/24 (21%)
P4Hc 115..262 CDD:214780 37/135 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.