DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and AT4G33910

DIOPT Version :10

Sequence 1:NP_730342.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:213 Identity:48/213 - (22%)
Similarity:84/213 - (39%) Gaps:55/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 LAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKL------------QRIEHLSGNCSCKIG 359
            :..:..:.||.:|....|..|...:..:.:  :.|.|:            :..|:..|..:....
plant    73 IGSIPFQVLSWRPRAIYFPNFATAEQCQAI--IERAKVNLKPSALALRKGETAENTKGTRTSSGT 135

  Fly   360 NLSTS------LHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNY-------NPEE--PKIH 409
            .:|.|      |..|.||    |...|..|....:...::.|.:...|       ||.|  |:..
plant   136 FISASEESTGALDFVERK----IARATMIPRSHGESFNILRYELGQKYDSHYDVFNPTEYGPQSS 196

  Fly   410 NKANAF-IFLSNAGKGGEIVFPSRH---------------LKVRPRKGSMLVWEN------LKKS 452
            .:..:| ::||:..:|||.:||..:               |||:||||..|::.:      :.::
plant   197 QRIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQT 261

  Fly   453 LIYHQCPILKGNMWVANK 470
            .::..||:.||..|||.|
plant   262 SLHGSCPVTKGEKWVATK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_730342.2 P4Ha_N 33..159 CDD:462433
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
PLN00052 311..>470 CDD:177683 47/207 (23%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 48/213 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.