DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and AT3G28480

DIOPT Version :10

Sequence 1:NP_730342.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:213 Identity:51/213 - (23%)
Similarity:93/213 - (43%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 PLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQR---IEHLSG-------------NCSCK 357
            |.::.:||..|.:.::.|||..::.:....:::.||::   .::.||             ..|..
plant    53 PTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMVADNDSGESVESEDSVSVVRQSSSF 117

  Fly   358 IGNL-STSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNPEEPKIHNKAN-------- 413
            |.|: |..:.|:|..|...:...|..|.:..:.:::::|.....|.|.....|::||        
plant   118 IANMDSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFDYFHDQANLELGGHRI 182

  Fly   414 --AFIFLSNAGKGGEIVFP-----SRHLK-------------VRPRKGSMLVWENL------KKS 452
              ..::|||..||||.|||     :..||             |:||||..|::.||      ..:
plant   183 ATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDALLFFNLHPNATTDSN 247

  Fly   453 LIYHQCPILKGNMWVANK 470
            .::..||:::|..|.|.:
plant   248 SLHGSCPVVEGEKWSATR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_730342.2 P4Ha_N 33..159 CDD:462433
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
PLN00052 311..>470 CDD:177683 50/209 (24%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 51/213 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.