Sequence 1: | NP_001034031.2 | Gene: | CG4174 / 40023 | FlyBaseID: | FBgn0036793 | Length: | 473 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_566279.1 | Gene: | P4H2 / 819804 | AraportID: | AT3G06300 | Length: | 299 | Species: | Arabidopsis thaliana |
Alignment Length: | 215 | Identity: | 52/215 - (24%) |
---|---|---|---|
Similarity: | 96/215 - (44%) | Gaps: | 46/215 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 TPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHL-SGNCSCKIGNLSTSL 365
Fly 366 HDVVRKVNE-LILGI-------TGFPLKGNQMLEVINYGIAGNYNPEEPKIHNKAN--------- 413
Fly 414 -AFIFLSNAGKGGEIVFP---------------------SRHLKVRPRKGSMLVWENLKKSLI-- 454
Fly 455 ----YHQCPILKGNMWVANK 470 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4174 | NP_001034031.2 | P4Ha_N | 33..157 | CDD:285528 | |
TPR repeat | 169..197 | CDD:276809 | |||
TPR repeat | 202..245 | CDD:276809 | |||
2OG-FeII_Oxy | <362..470 | CDD:304390 | 37/152 (24%) | ||
P4H2 | NP_566279.1 | P4Hc | 55..245 | CDD:214780 | 43/188 (23%) |
ShKT | 259..299 | CDD:214586 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I2378 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10869 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.060 |