DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4H2

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:215 Identity:52/215 - (24%)
Similarity:96/215 - (44%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 TPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHL-SGNCSCKIGNLSTSL 365
            :|...:.|.|::::|.||...::.|||...:.:.|.::::..|||.... :.|...::.::.||.
plant    28 SPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTSS 92

  Fly   366 HDVVRKVNE-LILGI-------TGFPLKGNQMLEVINYGIAGNYNPEEPKIHNKAN--------- 413
            ...:.|..: ::.||       |..|.:..:.|:|:.|.....|:......|:|.|         
plant    93 GTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARGGHRIA 157

  Fly   414 -AFIFLSNAGKGGEIVFP---------------------SRHLKVRPRKGSMLVWENLKKSLI-- 454
             ..::|||..||||.|||                     .:.:.|:|:||:.|::.||::..|  
plant   158 TVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAIPD 222

  Fly   455 ----YHQCPILKGNMWVANK 470
                :..||:::|..|.|.|
plant   223 PFSLHGGCPVIEGEKWSATK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
2OG-FeII_Oxy <362..470 CDD:304390 37/152 (24%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 43/188 (23%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.