DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and AT-P4H-1

DIOPT Version :10

Sequence 1:NP_730342.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:211 Identity:47/211 - (22%)
Similarity:89/211 - (42%) Gaps:50/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 LKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSCKIG-----NLSTS 364
            |::..:|.|.:|..|.|.:.:.||..::.|.||.::||:||    :|.....|.|     ::.||
plant    70 LRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQ----VSTVVDVKTGKGVKSDVRTS 130

  Fly   365 ----------LHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNPEEPKI----------H 409
                      .:.:::.:.:.|...:..|.:..::::|:.|.....|.|.....          .
plant   131 SGMFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYFADTFNLKRGGQ 195

  Fly   410 NKANAFIFLSNAGKGGEIVFP-------------SRHLKVRPRKG-SMLVW------ENLKKSLI 454
            ..|...::|::..:|||..||             .:.:.|:|.|| ::|.|      ::..:| |
plant   196 RVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRS-I 259

  Fly   455 YHQCPILKGNMWVANK 470
            :..|.:|.|..|.|.|
plant   260 HGGCEVLSGEKWSATK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_730342.2 P4Ha_N 33..159 CDD:462433
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
PLN00052 311..>470 CDD:177683 45/203 (22%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 44/201 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.