DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4H13

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:201 Identity:45/201 - (22%)
Similarity:80/201 - (39%) Gaps:50/201 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSCKIGNLS------TSLHD------ 367
            ||..|.:.....|..::..|.:.::::|||:     ....:.:.|..:      .|||.      
plant    71 LSWNPRVFYLPNFATKQQCEAVIDMAKPKLK-----PSTLALRKGETAETTQNYRSLHQHTDEDE 130

  Fly   368 --VVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNPEEPKIHNK----------ANAFIFLSN 420
              |:..:.|.|...|.||....:...::.|.:...|:......|:.          ....:|||:
plant   131 SGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEYGPLISQRVVTFLLFLSS 195

  Fly   421 AGKGGEIVFPSRH---------------LKVRPRKGSMLVWENL------KKSLIYHQCPILKGN 464
            ..:|||.:||..:               |||:||:|..:.:.||      .::.::..||::||.
plant   196 VEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGE 260

  Fly   465 MWVANK 470
            .|||.|
plant   261 KWVATK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
2OG-FeII_Oxy <362..470 CDD:304390 35/152 (23%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 41/187 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.