DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4H5

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:203 Identity:49/203 - (24%)
Similarity:90/203 - (44%) Gaps:44/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 MEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRI----EHLSGNCSCKIGNLSTSL----HD- 367
            :|.:|.:|...:::.||..::.|.|.::::|.:.:.    |...|:...::...|.:.    || 
plant    80 VEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLRRGHDE 144

  Fly   368 VVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP------EEPKIHNK----ANAFIFLSNAG 422
            ||..:.:.|...|..|::..:.|:|::|.:...|.|      :|....|.    |...::||:..
plant   145 VVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVD 209

  Fly   423 KGGEIVFPSRH-------------------LKVRPRK-GSMLVWE-----NLKKSLIYHQCPILK 462
            .|||.|||:..                   |.|.|:| .::|.|.     :|..|.::..||::|
plant   210 DGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGCPVVK 274

  Fly   463 GNMWVANK 470
            ||.|.:.|
plant   275 GNKWSSTK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
2OG-FeII_Oxy <362..470 CDD:304390 38/147 (26%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 49/203 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.