DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and p4htmb

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:366 Identity:66/366 - (18%)
Similarity:125/366 - (34%) Gaps:130/366 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LELALYHYDDNVSPE--VLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLT 254
            |:..|:...|.:|.|  .:.::|.....|:||.|...:|       ::..::.|:::|...:...
Zfish   153 LKPLLFEIPDFLSEEECAVVVRLAQLKGLMESQVMVPEG-------QEELDQQLNLSPEEIFNFL 210

  Fly   255 QLPKLKHLQSNPAKLTKPKKVFQLQKEICSKRYRRKSGVLVCRYVDWTPFLKLAP---------- 309
            .|.:...||  |.::....:|              :.|:       |.....|..          
Zfish   211 DLNQDGQLQ--PHEILTHSRV--------------RDGI-------WLTSENLKEIYDGLKADLD 252

  Fly   310 ----LKMEELSMKPYISIFYGFLGQKDIE---VLKNVSRPKLQRIEHLSGNCSCKIGNLSTSLHD 367
                |.:||.. :.....|..||.|:.:|   :::|.....|.:               ....|.
Zfish   253 GNGLLSLEEFG-RLRSDAFQRFLLQRGVERSQLVRNSRHTWLYQ---------------GQGAHQ 301

  Fly   368 VVRKVNELILGITGFP---LKGNQMLEVINYGIAGNYN---------PEEPKIHNKANA------ 414
            |::.:.:.:..:|..|   ::.::.|:|:.|...|:|:         ||....|.:..|      
Zfish   302 VLQDLRKRVTLLTRLPSSLVELSEPLQVVRYEQGGHYHAHHDSGPVYPETACTHTRLAANTTSPF 366

  Fly   415 ---------FIFLSNAGKGGEIVFP----------------------SRH-----LKVRPRKGSM 443
                     ..:|:|..:|||..||                      .:|     |:|:|.||:.
Zfish   367 QTSCRYITVLFYLNNVQEGGETTFPVADNRTYEEASLIQNDVDLLDTRKHCDKGNLRVKPVKGTA 431

  Fly   444 LVWENL-----------KKSLIYHQCPILKGNMWVANKVLN 473
            :.|.|.           .:..::..|.:.:|..||||..:|
Zfish   432 VFWYNYLSDGRGWVGEQDEYSLHGGCVVTQGTKWVANNWIN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809 1/4 (25%)
TPR repeat 202..245 CDD:276809 9/44 (20%)
2OG-FeII_Oxy <362..470 CDD:304390 33/172 (19%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 10/80 (13%)
EFh 204..262 CDD:298682 10/80 (13%)
P4Hc 285..471 CDD:214780 36/200 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.