DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and p4htma

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:359 Identity:77/359 - (21%)
Similarity:123/359 - (34%) Gaps:146/359 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LKIKLWNYPNLLESLVEAN--------KGLGHYFEAKKYANELLSINPNHTYMLTQ--------- 255
            ||..|:..|..| |:.|:|        |||.|        :.||: ||:....|||         
Zfish   138 LKPLLFEIPGFL-SVEESNVVMQLAQLKGLTH--------SSLLT-NPDQEEQLTQDELFSLLDL 192

  Fly   256 ----------LPKLKH------LQS-NPAKL-----TKPKKVFQLQKEICSKRYRRKSGVLVCRY 298
                      :..|.|      |.| |..|:     |.|..|..||:      ::|.||. |.||
Zfish   193 NQDGLLQREEILSLSHSTDGSWLSSYNLRKIHTGLETNPSGVLSLQE------FKRVSGG-VLRY 250

  Fly   299 VDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSCKIGNLST 363
            ......|. ...|:.:.|....:     :||:....:||:|.    .|:..|:        .|.:
Zfish   251 SGAAQGLD-GHTKVRQRSTHTRL-----YLGEGTHHLLKSVR----NRVTRLT--------RLPS 297

  Fly   364 SLHDVVRKVNELILGITGFPLKGNQMLEVINY--GIAGNYNPEEPKIH------------NKAN- 413
            ||.|:                  ::.:||:.|  |:..:.:.:....|            |.:| 
Zfish   298 SLVDL------------------SEAMEVVRYEQGVFSHAHHDSSPTHPDNSCTHTHLAANTSNQ 344

  Fly   414 -------AFIFLSNAGKGGEIVFP---------------------SRHLKVRPRKGSMLVWEN-- 448
                   ..::|::|..|||..||                     ..:|||:|..|:.|:|.|  
Zfish   345 VACRYLTVLLYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYNHL 409

  Fly   449 ---------LKKSLIYHQCPILKGNMWVANKVLN 473
                     |.:..::..|.:.:|..|..:..:|
Zfish   410 SDGNGWVGELDEFSLHGDCLVTRGFKWTGSVWVN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809 14/44 (32%)
2OG-FeII_Oxy <362..470 CDD:304390 29/161 (18%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 37/204 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.