DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4ha1

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_742059.2 Gene:P4ha1 / 64475 RGDID:621000 Length:534 Species:Rattus norvegicus


Alignment Length:515 Identity:131/515 - (25%)
Similarity:222/515 - (43%) Gaps:87/515 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSPRNL----IYGY 89
            |..|......|:..::..|.:|:.|.|..:..|::|::...:.:.|..:....|...    :..:
  Rat    21 FFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAF 85

  Fly    90 KVLRHLHNDWPQYFRLLKKDL--GLEQIAVSQMLLTQQ--PTSVDFEESMGAMHRLQTVYNLDSY 150
            |:::.|:.:|.:...|:.||:  |.    :|.:.:.:|  |...|...:..|:.|||..||||:.
  Rat    86 KLMKRLNTEWSELENLILKDMSDGF----ISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTN 146

  Fly   151 AMTEGFIDD-KDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIKLWN 214
            .:::|.:.. |.|:.  .:|::|..||.:.....||..:|.|:|.||...::.....|.|:.:.:
  Rat   147 TISKGNLPGVKHKSF--LTAEDCFELGKVAYTEADYYHTELWMEQALMQLEEGEMSTVDKVSVLD 209

  Fly   215 YPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHLQSNPA------------ 267
            |      |..|....|...:|.....:||.::|.|......|...:::.|...            
  Rat   210 Y------LSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSD 268

  Fly   268 KLTKPKK---------VFQLQKEICS----KRYRRKSGVLVCRYVDW--TPFLKLAPLKMEELSM 317
            :.|.|||         ..|..:.:|.    |...|:...|.|||.|.  .|...|||.|.|:...
  Rat   269 QKTTPKKKGIAVDYLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWD 333

  Fly   318 KPYISIFYGFLGQKDIEVLKNVSRPKLQRIE-HLSGNCSCKIGNLSTSLH-------------DV 368
            ||.|..|:..:...:||::|::::|:|.|.. |     ..:.|.|:|:.:             .|
  Rat   334 KPRIIRFHDIISDAEIEIVKDLAKPRLSRATVH-----DPETGKLTTAQYRVSKSAWLSGYEDPV 393

  Fly   369 VRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP-------EEPKIHNK-------ANAFIFLS 419
            |.::|..|..:||..:...:.|:|.|||:.|.|.|       :||....:       |....::|
  Rat   394 VSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMS 458

  Fly   420 NAGKGGEIVFPSRHLKVRPRKGSMLVWENL------KKSLIYHQCPILKGNMWVANKVLN 473
            :...||..|||.....|.|:||:.:.|.||      ..|..:..||:|.||.||:||.|:
  Rat   459 DVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 29/131 (22%)
TPR repeat 169..197 CDD:276809 10/27 (37%)
TPR repeat 202..245 CDD:276809 9/42 (21%)
2OG-FeII_Oxy <362..470 CDD:304390 39/140 (28%)
P4ha1NP_742059.2 P4Ha_N 25..112 CDD:400573 16/90 (18%)
TPR 205..238 8/38 (21%)
P4Hc 345..518 CDD:214780 50/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.